About this book

Über die Evolution marktwirtschaftlicher-kapitalistischer Gesellschaftssysteme, written by Wolfram Braun, is now in the public domain and available here for free download. this title joins thousands of works in our economics collection.

Click the download button above to receive the complete text in your preferred ebook format—PDF, EPUB, MOBI, or plain text.

See all →

Financial audit
Cover of Circulaire a MM. les curés du diocèse by Charles-François Baillargeon

Circulaire a MM. les curés du diocèse
Cover of Think and Grow Rich by Napoleon Hill

Think and Grow Rich
Cover of How to live on 24 hours a day by Arnold Bennett

How to live on 24 hours a day

Tax administration
Cover of The art of money getting, or, Golden rules for money getting by P. T. Barnum

The art of money getting, or, Golden rules for money getting